PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067800001
Common NameGSBRNA2T00067800001, LOC106416020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 520aa    MW: 58902.4 Da    PI: 6.337
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067800001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14.1e-103674041954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  GSBRNA2T00067800001 367 FEHflHPYPKEAEKMMLAKQTGLSKNQVANWFINARVR 404
                          664459******************************88 PP

2BELL113.61e-36223294172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vag gsakpYts+Al++iS +Fr+L+dai+eqi
  GSBRNA2T00067800001 223 ERQELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGFGSAKPYTSVALNKISCSFRSLRDAIKEQI 294
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.0E-45156292IPR006563POX domain
PfamPF075264.4E-45162290IPR006563POX domain
PROSITE profilePS5007112.552345408IPR001356Homeobox domain
SMARTSM003891.1E-9348412IPR001356Homeobox domain
CDDcd000866.74E-12348409No hitNo description
SuperFamilySSF466893.08E-17349413IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27351412IPR009057Homeodomain-like
PfamPF059204.3E-18365404IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MAVYYSSNAN CYQQEPIYLN HQQQQQQQAS SSSAAASFVG ENVRNEMAFI PPTTGLQTLN  60
GDVTGNGAVS SSDLSFYDGQ GLSLSLGNQI SLPSFHHQQY HHLGFTPNPS ISAKETPPFD  120
VEEKSKEMML SLVGQSDPSS GYAGLYNNYR FNETSGGFMS GVLRSRYLKP AQNLLDEVVS  180
VKKELNQMRK KKKKKKGEDF SNGSKDTQGE LSTDSNVKLC TIERQELQNK KNKLLTMVDE  240
VDKRYNQYYH QMEALASSFE IVAGFGSAKP YTSVALNKIS CSFRSLRDAI KEQIQIIREK  300
LGEKGGGELS LDEHQGGGER IPRLRYLDQR LRQQRAFHQQ LGMVRPSWRP QRGLPENSVS  360
VLRAWLFEHF LHPYPKEAEK MMLAKQTGLS KNQVANWFIN ARVRLWKPMI EDIYKEEFGD  420
ESELQISKSP QEPNSTNQED SSSQQQQEDN KNNLAYPSAD TTNIDDEPQQ QQMNRSGDYE  480
TLMNNYQGFG VEEEYRYVGG SNQEDSRFSN AHHLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16354411562Homeobox protein Meis2
3k2a_B6e-16354411562Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1187194MRKKKKKK
2189195KKKKKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.200690.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00067800001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895580.0AC189558.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006P24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013712298.10.0PREDICTED: BEL1-like homeodomain protein 10 isoform X2
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A078HPM80.0A0A078HPM8_BRANA; BnaC05g15280D protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]